PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00835.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 325aa    MW: 37715.8 Da    PI: 4.7189
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00835.1_g00007.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM32.32.9e-102113211128
                      NAM  11 deelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                              de  ++ yL+   ++ +   e ++ ++++++ +P++      ++e+  + F+   ++     r+    +sg W+  g+dk ++++ 
  Rsa1.0_00835.1_g00007.1  21 DEKTMSIYLQSMKDSGDSWPEYFFGDTNLFTKNPSEVL----ESENPFFVFVYPITE--ACGRTDG-CDSGGWRIIGRDKLIKDEe 99 
                              77788888888777666444456999999999999985....233444555554443..3345555.47899***********987 PP

                      NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              +g+  g kk+L f  +++ +g k +Wvm+++rl
  Rsa1.0_00835.1_g00007.1 100 TGKILGFKKILKFCGETKARGYKRTWVMEQFRL 132
                              78889*********99***************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100520.11911150IPR003441NAC domain
SuperFamilySSF1019419.42E-2120148IPR003441NAC domain
PfamPF023652.0E-520132IPR003441NAC domain
PROSITE profilePS5100511.35175324IPR003441NAC domain
SuperFamilySSF1019411.57E-17191322IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MEEIRVAKSA YTKDDHSKAN DEKTMSIYLQ SMKDSGDSWP EYFFGDTNLF TKNPSEVLES  60
ENPFFVFVYP ITEACGRTDG CDSGGWRIIG RDKLIKDEET GKILGFKKIL KFCGETKARG  120
YKRTWVMEQF RLPSKWNPKQ DHVVCKIQLL FQTEISYLLA KHFSYSSDLL PPTQSLPAYG  180
VCLANPQDDG AYHLQTIFDS VGNKWPSYVT NDVYCVHPST LVDHKDMRFL ESGLCIFADQ  240
TEDCGYTDGC ESGRWRIMEE HDAIYSMSYE VMGYRRVFKF CEEDEDKFFD IENGEEVLLT  300
WIMEEYRLVE EAMKDKVLCV IKLCR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013594418.10.0PREDICTED: uncharacterized protein LOC106302454
TrEMBLA0A0D3AA880.0A0A0D3AA88_BRAOL; Uncharacterized protein
STRINGBra035412.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM37041459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G60280.11e-112NAC domain containing protein 23